PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014233-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 204aa    MW: 23370.4 Da    PI: 8.6762
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014233-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.65.9e-20867357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++t+eql +Lee++++  r+p+a+++++++++l    +++ ++V++WFqN++a++++
  WALNUT_00014233-RA  8 SRWCPTSEQLMILEEMYRSgIRTPNASQIQKITANLsfygKIEGKNVFYWFQNHKARDRQ 67
                        7*****************99*************************************996 PP

2Wus_type_Homeobox119.71.3e-38668264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        a++RW+Pt+eQ++iLee+y+sG+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
  WALNUT_00014233-RA  6 ASSRWCPTSEQLMILEEMYRSGIRTPNASQIQKITANLSFYGKIEGKNVFYWFQNHKARDRQK 68
                        689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.5E-4572IPR001356Homeobox domain
SuperFamilySSF466896.84E-11867IPR009057Homeodomain-like
PfamPF000461.1E-17867IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-7867IPR009057Homeodomain-like
CDDcd000861.13E-4968No hitNo description
PROSITE profilePS5007110.0421368IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MSPVAASSRW CPTSEQLMIL EEMYRSGIRT PNASQIQKIT ANLSFYGKIE GKNVFYWFQN  60
HKARDRQKLR RKVSRQLQLQ QQQHYYQMNQ SNDRFPGYYE SPSSPALPQL FFFDSSVSFL  120
PQEGVAGAST QAMNHTWKVD IPQRAEIIEK STMTTYGYDG NATVEMGPIS YCCSTRPLQT  180
LELFPVTATN LKEECSATSK QYCL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016605.13e-77Homeodomain-like superfamily protein, putative
TrEMBLA0A061H0613e-77A0A061H061_THECC; Homeodomain-like superfamily protein, putative
STRINGGLYMA18G39520.24e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106322940
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-36WOX family protein